New analysis

Analysis information
Name New analysis
Created Dec. 30, 2016, 11:14 p.m.
Predictor PMut2017
Variants 360 variants Show variants
P21580   12. L > F
P21580   16. R > Q
P21580   18. A > P
P21580   20. K > QR
P21580   21. I > TV
P21580   22. R > Q
P21580   25. T > I
P21580   27. E > D
P21580   29. I > F
P21580   30. F > L
P21580   33. T > A
P21580   36. I > F
P21580   39. H > Y
P21580   40. F > C
P21580   42. T > S
P21580   58. P > T
P21580   61. R > Q
P21580   63. I > N
P21580   65. H > R
P21580   66. K > E
P21580   67. A > GT
P21580   70. D > N
P21580   71. R > G
P21580   74. Q > H
P21580   76. T > S
P21580   79. S > R
P21580   81. K > R
P21580   83. L > P
P21580   85. W > RS
P21580   86. C > Y
P21580   87. R > G
P21580   90. R > W
P21580   93. V > A
P21580   94. A > V
P21580   97. T > M
P21580   99. G > S
P21580  102. N > S
P21580  103. C > G
P21580  105. M > L
P21580  106. H > R
P21580  108. T > A
P21580  109. S > F
P21580  112. M > T
P21580  115. V > I
P21580  117. D > GV
P21580  120. L > W
P21580  122. L > P
P21580  125. A > V
P21580  127. F > CLS
P21580  129. T > KM
P21580  131. K > Q
P21580  136. R > CH
P21580  145. E > A
P21580  154. E > K
P21580  155. T > AM
P21580  157. L > P
P21580  162. R > LQW
P21580  170. N > S
P21580  172. I > T
P21580  173. K > T
P21580  180. P > S
P21580  181. M > K
P21580  182. A > D
P21580  183. R > LQ
P21580  184. S > N
P21580  189. N > S
P21580  190. S > LP
P21580  194. I > T
P21580  205. R > S
P21580  206. P > L
P21580  207. I > LV
P21580  208. I > FV
P21580  209. V > I
P21580  210. I > F
P21580  211. S > L
P21580  212. D > G
P21580  213. K > Q
P21580  214. M > R
P21580  217. S > T
P21580  219. E > G
P21580  225. A > T
P21580  226. P > H
P21580  235. P > T
P21580  240. A > T
P21580  243. C > Y
P21580  248. I > V
P21580  251. G > S
P21580  253. D > EY
P21580  254. S > IN
P21580  258. V > IL
P21580  271. R > LQ
P21580  277. N > D
P21580  280. R > QW
P21580  281. G > E
P21580  288. V > A
P21580  294. P > L
P21580  300. E > KV
P21580  302. L > P
P21580  304. K > E
P21580  307. L > V
P21580  308. M > TV
P21580  310. I > T
P21580  314. V > I
P21580  319. H > N
P21580  323. H > R
P21580  327. A > S
P21580  328. A > T
P21580  332. E > G
P21580  335. L > V
P21580  345. Y > H
P21580  350. Q > H
P21580  353. Y > F
P21580  354. K > E
P21580  356. W > R
P21580  358. E > G
P21580  359. N > K
P21580  361. E > K
P21580  364. R > GK
P21580  367. G > RV
P21580  368. H > D
P21580  374. E > D
P21580  375. P > S
P21580  377. V > AM
P21580  380. L > P
P21580  381. S > F
P21580  382. L > V
P21580  383. M > L
P21580  391. N > KS
P21580  394. F > L
P21580  398. V > A
P21580  403. L > S
P21580  405. H > R
P21580  406. E > KQ
P21580  411. R > Q
P21580  415. Q > K
P21580  421. L > MV
P21580  425. P > LRS
P21580  427. P > L
P21580  428. E > K
P21580  431. P > L
P21580  434. A > EV
P21580  435. L > P
P21580  436. G > R
P21580  439. R > LPQW
P21580  441. E > K
P21580  443. Y > C
P21580  444. E > K
P21580  447. A > TV
P21580  448. W > CG
P21580  449. N > IKY
P21580  450. P > L
P21580  451. E > V
P21580  452. E > G
P21580  455. G > EV
P21580  456. G > V
P21580  457. P > L
P21580  462. P > Q
P21580  464. A > V
P21580  466. S > IR
P21580  467. P > H
P21580  471. S > R
P21580  474. T > AN
P21580  476. M > I
P21580  482. G > S
P21580  490. Q > R
P21580  492. N > S
P21580  493. G > R
P21580  497. R > H
P21580  500. N > S
P21580  501. A > T
P21580  502. R > QW
P21580  504. L > F
P21580  505. H > Q
P21580  506. A > ST
P21580  507. S > GN
P21580  509. A > T
P21580  511. D > E
P21580  516. L > W
P21580  517. D > EN
P21580  519. G > R
P21580  522. Q > E
P21580  523. A > T
P21580  531. T > I
P21580  544. T > A
P21580  545. A > V
P21580  550. S > G
P21580  551. L > F
P21580  555. L > V
P21580  559. C > GS
P21580  565. S > L
P21580  566. D > Y
P21580  568. S > L
P21580  571. V > AIL
P21580  572. R > Q
P21580  574. P > L
P21580  576. P > L
P21580  577. H > R
P21580  579. C > S
P21580  580. H > R
P21580  581. R > G
P21580  585. D > N
P21580  586. A > TV
P21580  587. P > L
P21580  588. A > G
P21580  591. L > MPV
P21580  595. A > T
P21580  596. R > GW
P21580  597. T > I
P21580  598. P > R
P21580  600. D > NY
P21580  602. T > M
P21580  604. T > MR
P21580  609. K > N
P21580  611. G > S
P21580  613. V > M
P21580  614. Y > C
P21580  617. T > A
P21580  622. G > C
P21580  627. C > Y
P21580  629. I > F
P21580  630. E > K
P21580  631. Y > C
P21580  633. E > GK
P21580  636. H > Y
P21580  642. G > R
P21580  645. S > C
P21580  646. P > L
P21580  647. T > P
P21580  648. A > PV
P21580  654. T > IN
P21580  656. P > L
P21580  659. G > R
P21580  661. E > GQ
P21580  663. G > S
P21580  665. L > V
P21580  666. G > E
P21580  668. T > N
P21580  669. M > T
P21580  678. F > L
P21580  679. I > T
P21580  685. R > G
P21580  694. E > G
P21580  697. R > K
P21580  698. S > L
P21580  701. R > CH
P21580  704. V > A
P21580  706. R > Q
P21580  709. Q > P
P21580  714. P > AS
P21580  715. K > E
P21580  716. C > G
P21580  717. A > ST
P21580  718. R > Q
P21580  721. C > G
P21580  723. N > D
P21580  728. R > CH
P21580  730. E > K
P21580  733. C > F
P21580  737. Q > K
P21580  738. H > L
P21580  743. M > LV
P21580  744. G > DS
P21580  745. P > S
P21580  748. H > Q
P21580  749. R > QW
P21580  751. E > GK
P21580  752. P > S
P21580  753. A > T
P21580  754. P > LT
P21580  755. E > K
P21580  757. P > T
P21580  758. P > HLR
P21580  761. R > HL
P21580  763. R > Q
P21580  766. A > PT
P21580  772. N > KS
P21580  773. A > DPS
P21580  776. N > S
P21580  777. G > S
P21580  778. Y > C
P21580  781. E > ADG
P21580  786. K > T
P21580  788. M > I
Protein P21580 Show sequence
>P21580
MAEQVLPQALYLSNMRKAVKIRERTPEDIFKPTNGIIHHFKTMHRYTLEMFRTCQFCPQF
REIIHKALIDRNIQATLESQKKLNWCREVRKLVALKTNGDGNCLMHATSQYMWGVQDTDL
VLRKALFSTLKETDTRNFKFRWQLESLKSQEFVETGLCYDTRNWNDEWDNLIKMASTDTP
MARSGLQYNSLEEIHIFVLCNILRRPIIVISDKMLRSLESGSNFAPLKVGGIYLPLHWPA
QECYRYPIVLGYDSHHFVPLVTLKDSGPEIRAVPLVNRDRGRFEDLKVHFLTDPENEMKE
KLLKEYLMVIEIPVQGWDHGTTHLINAAKLDEANLPKEINLVDDYFELVQHEYKKWQENS
EQGRREGHAQNPMEPSVPQLSLMDVKCETPNCPFFMSVNTQPLCHECSERRQKNQNKLPK
LNSKPGPEGLPGMALGASRGEAYEPLAWNPEESTGGPHSAPPTAPSPFLFSETTAMKCRS
PGCPFTLNVQHNGFCERCHNARQLHASHAPDHTRHLDPGKCQACLQDVTRTFNGICSTCF
KRTTAEASSSLSTSLPPSCHQRSKSDPSRLVRSPSPHSCHRAGNDAPAGCLSQAARTPGD
RTGTSKCRKAGCVYFGTPENKGFCTLCFIEYRENKHFAAASGKVSPTASRFQNTIPCLGR
ECGTLGSTMFEGYCQKCFIEAQNQRFHEAKRTEEQLRSSQRRDVPRTTQSTSRPKCARAS
CKNILACRSEELCMECQHPNQRMGPGAHRGEPAPEDPPKQRCRAPACDHFGNAKCNGYCN
ECFQFKQMYG
Computation status Completed
  • 2 / 2 BLAST
  • 2 / 2 Kalign
  • 360 / 360 Features
  • 360 / 360 Predictions
Protein Position Mutation Prediction
P21580 12 L → F (Leu → Phe) 0.18 (93%)    Neutral
P21580 16 R → Q (Arg → Gln) 0.29 (89%)    Neutral
P21580 18 A → P (Ala → Pro) 0.43 (85%)    Neutral
P21580 20 K → Q (Lys → Gln) 0.29 (89%)    Neutral
P21580 20 K → R (Lys → Arg) 0.27 (90%)    Neutral
P21580 21 I → T (Ile → Thr) 0.60 (83%)    Disease
P21580 21 I → V (Ile → Val) 0.25 (91%)    Neutral
P21580 22 R → Q (Arg → Gln) 0.66 (85%)    Disease
P21580 25 T → I (Thr → Ile) 0.11 (95%)    Neutral
P21580 27 E → D (Glu → Asp) 0.12 (95%)    Neutral
P21580 29 I → F (Ile → Phe) 0.13 (94%)    Neutral
P21580 30 F → L (Phe → Leu) 0.20 (92%)    Neutral
P21580 33 T → A (Thr → Ala) 0.07 (96%)    Neutral
P21580 36 I → F (Ile → Phe) 0.21 (92%)    Neutral
P21580 39 H → Y (His → Tyr) 0.30 (89%)    Neutral
P21580 40 F → C (Phe → Cys) 0.54 (80%)    Disease
P21580 42 T → S (Thr → Ser) 0.08 (96%)    Neutral
P21580 58 P → T (Pro → Thr) 0.45 (84%)    Neutral
P21580 61 R → Q (Arg → Gln) 0.11 (95%)    Neutral
P21580 63 I → N (Ile → Asn) 0.54 (80%)    Disease
P21580 65 H → R (His → Arg) 0.58 (82%)    Disease
P21580 66 K → E (Lys → Glu) 0.15 (94%)    Neutral
P21580 67 A → G (Ala → Gly) 0.53 (80%)    Disease
P21580 67 A → T (Ala → Thr) 0.33 (88%)    Neutral
P21580 70 D → N (Asp → Asn) 0.45 (84%)    Neutral
P21580 71 R → G (Arg → Gly) 0.31 (89%)    Neutral
P21580 74 Q → H (Gln → His) 0.46 (84%)    Neutral
P21580 76 T → S (Thr → Ser) 0.03 (98%)    Neutral
P21580 79 S → R (Ser → Arg) 0.07 (97%)    Neutral
P21580 81 K → R (Lys → Arg) 0.11 (95%)    Neutral
P21580 83 L → P (Leu → Pro) 0.69 (85%)    Disease
P21580 85 W → R (Trp → Arg) 0.86 (91%)    Disease
P21580 85 W → S (Trp → Ser) 0.86 (91%)    Disease
P21580 86 C → Y (Cys → Tyr) 0.62 (83%)    Disease
P21580 87 R → G (Arg → Gly) 0.22 (92%)    Neutral
P21580 90 R → W (Arg → Trp) 0.62 (83%)    Disease
P21580 93 V → A (Val → Ala) 0.46 (84%)    Neutral
P21580 94 A → V (Ala → Val) 0.13 (94%)    Neutral
P21580 97 T → M (Thr → Met) 0.58 (82%)    Disease
P21580 99 G → S (Gly → Ser) 0.30 (89%)    Neutral
Protein Position Mutation Prediction
P21580 102 N → S (Asn → Ser) 0.61 (83%)    Disease
P21580 103 C → G (Cys → Gly) 0.86 (91%)    Disease
P21580 105 M → L (Met → Leu) 0.09 (96%)    Neutral
P21580 106 H → R (His → Arg) 0.68 (85%)    Disease
P21580 108 T → A (Thr → Ala) 0.01 (99%)    Neutral
P21580 109 S → F (Ser → Phe) 0.51 (79%)    Disease
P21580 112 M → T (Met → Thr) 0.52 (79%)    Disease
P21580 115 V → I (Val → Ile) 0.09 (96%)    Neutral
P21580 117 D → G (Asp → Gly) 0.84 (90%)    Disease
P21580 117 D → V (Asp → Val) 0.86 (91%)    Disease
P21580 120 L → W (Leu → Trp) 0.65 (84%)    Disease
P21580 122 L → P (Leu → Pro) 0.84 (90%)    Disease
P21580 125 A → V (Ala → Val) 0.18 (93%)    Neutral
P21580 127 F → C (Phe → Cys) 0.09 (96%)    Neutral
P21580 127 F → L (Phe → Leu) 0.51 (79%)    Disease
P21580 127 F → S (Phe → Ser) 0.40 (86%)    Neutral
P21580 129 T → K (Thr → Lys) 0.58 (82%)    Disease
P21580 129 T → M (Thr → Met) 0.08 (96%)    Neutral
P21580 131 K → Q (Lys → Gln) 0.17 (93%)    Neutral
P21580 136 R → C (Arg → Cys) 0.53 (80%)    Disease
P21580 136 R → H (Arg → His) 0.14 (94%)    Neutral
P21580 145 E → A (Glu → Ala) 0.31 (89%)    Neutral
P21580 154 E → K (Glu → Lys) 0.24 (91%)    Neutral
P21580 155 T → A (Thr → Ala) 0.26 (90%)    Neutral
P21580 155 T → M (Thr → Met) 0.48 (83%)    Neutral
P21580 157 L → P (Leu → Pro) 0.68 (85%)    Disease
P21580 162 R → L (Arg → Leu) 0.39 (87%)    Neutral
P21580 162 R → Q (Arg → Gln) 0.28 (90%)    Neutral
P21580 162 R → W (Arg → Trp) 0.52 (80%)    Disease
P21580 170 N → S (Asn → Ser) 0.07 (97%)    Neutral
P21580 172 I → T (Ile → Thr) 0.53 (80%)    Disease
P21580 173 K → T (Lys → Thr) 0.30 (89%)    Neutral
P21580 180 P → S (Pro → Ser) 0.11 (95%)    Neutral
P21580 181 M → K (Met → Lys) 0.17 (93%)    Neutral
P21580 182 A → D (Ala → Asp) 0.24 (91%)    Neutral
P21580 183 R → L (Arg → Leu) 0.33 (88%)    Neutral
P21580 183 R → Q (Arg → Gln) 0.08 (96%)    Neutral
P21580 184 S → N (Ser → Asn) 0.03 (98%)    Neutral
P21580 189 N → S (Asn → Ser) 0.09 (96%)    Neutral
P21580 190 S → L (Ser → Leu) 0.68 (85%)    Disease